PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OBART07G22710.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family CAMTA
Protein Properties Length: 1024aa    MW: 114603 Da    PI: 6.7287
Description CAMTA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OBART07G22710.2genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CG-1180.42.1e-56211372118
             CG-1   2 lkekkrwlkneeiaaiLenfekheltlelktrpksgsliLynrkkvryfrkDGyswkkkkdgktvrEdhekLKvggvevlycyYahseenptfq 95 
                      l+ ++rwl+++ei++iL n++k++++ e+++rp sgsl+L++rk++ryfrkDG++w+kkkdgktv+E+hekLKvg+v+vl+cyYah+een++fq
  OBART07G22710.2  21 LEAQNRWLRPTEICHILSNYKKFSIAPEPPNRPASGSLFLFDRKILRYFRKDGHNWRKKKDGKTVKEAHEKLKVGSVDVLHCYYAHGEENENFQ 114
                      5679****************************************************************************************** PP

             CG-1  96 rrcywlLeeelekivlvhylevk 118
                      rr+ywlLee + +ivlvhylevk
  OBART07G22710.2 115 RRTYWLLEEGFMNIVLVHYLEVK 137
                      ********************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5143780.0316142IPR005559CG-1 DNA-binding domain
SMARTSM010762.5E-7619137IPR005559CG-1 DNA-binding domain
PfamPF038593.4E-5022136IPR005559CG-1 DNA-binding domain
Gene3DG3DSA:2.60.40.106.5E-5428515IPR013783Immunoglobulin-like fold
PfamPF018331.5E-4429502IPR002909IPT domain
SuperFamilySSF812961.71E-16429515IPR014756Immunoglobulin E-set
SuperFamilySSF484031.71E-16616722IPR020683Ankyrin repeat-containing domain
Gene3DG3DSA:1.25.40.201.6E-17621723IPR020683Ankyrin repeat-containing domain
CDDcd002047.06E-13622720No hitNo description
PROSITE profilePS5029717.263628722IPR020683Ankyrin repeat-containing domain
PfamPF127964.3E-7634723IPR020683Ankyrin repeat-containing domain
PROSITE profilePS500889.618661693IPR002110Ankyrin repeat
SMARTSM002480.055661690IPR002110Ankyrin repeat
SMARTSM00248670700729IPR002110Ankyrin repeat
SMARTSM000154.2834856IPR000048IQ motif, EF-hand binding site
PROSITE profilePS500968.718835864IPR000048IQ motif, EF-hand binding site
PfamPF006120.0055836855IPR000048IQ motif, EF-hand binding site
SuperFamilySSF525402.1E-7836885IPR027417P-loop containing nucleoside triphosphate hydrolase
SMARTSM000150.0096857879IPR000048IQ motif, EF-hand binding site
PROSITE profilePS500969.633858882IPR000048IQ motif, EF-hand binding site
PfamPF006122.4E-4860879IPR000048IQ motif, EF-hand binding site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0050826Biological Processresponse to freezing
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005516Molecular Functioncalmodulin binding
Sequence ? help Back to Top
Protein Sequence    Length: 1024 aa     Download sequence    Send to blast
MAEVRKYGLP NQPPDISQIL LEAQNRWLRP TEICHILSNY KKFSIAPEPP NRPASGSLFL  60
FDRKILRYFR KDGHNWRKKK DGKTVKEAHE KLKVGSVDVL HCYYAHGEEN ENFQRRTYWL  120
LEEGFMNIVL VHYLEVKGKN NFSRVASKVS AVLKKLKRVQ DYLMLIVLHA QTLSLVRASV  180
SKEKFGATDN CRASSRYHPF VEMQQPVDGV MMNNMLGVSA PRYHGEMQTT TANSDNHFAT  240
HYDIAGVFNE AGAGLRGVSK TLHDSVRFAE PYPECSAEFM EPALYSSNAT MESNNLDDNS  300
RLETFMSEAL YTNNLTQKEA DALSAAGIMS SQAENNSYTD GIRYPLLKQS SLDLFKIEPD  360
GLKKFDSFSR WMSSELPEVA DLDIKSSSDA FWSSTETVNV ADGTSIPINE QLDAFAVSPS  420
LSQDQLFSII DVSPSYACTG SRNKVLITGT FLANKEHVEN CKWSCMFGDV EVPAEVLAHG  480
SLRCYTPVHL SGRVPFYVTC SNRVACSEVR EFEFRDSDAR QMDTSDPQTT GINEMHLHIR  540
LEKLLSLGPD DYEKYVMSDG KEKSEIINTI SSLMLDDKCL NQAVPLDEKE VSTARDQNIE  600
KLVKEKLYCW LVHKVHDEDK GPNVLGKEGQ GVIHLVAALG YDWAVRPIIT AGVKVNFRDA  660
RGWTALHWAA SCGRERTVGA LIANGAESGL LTDPTPQFPA GRTAADLASE NGHKGIAGFL  720
AESALTSHLS ALTLKESKDG NVKEICGLGG AEDFAESSSA QLAYRDSQAE SLKDSLSAVR  780
KSTQAAARIF QAFRVESFHR KKVVEYGDDD CGLSDERTLS LVSIKNAKPG QNDGSHSAAV  840
RIQNKFRGWK GRKEFMIIRQ KIVKIQAHVR GHQVRKSYRR IVWSVGIVEK IILRWRRKRR  900
GLRGFQPVKQ LEGPSPIQQL EGPSQIQPAK EEEEDEYDYL KDGRKQAEGR LQRALARVKS  960
MTQYPEAREQ YSRIANRVTE LQEPQAMMIQ DDMQSDGAIA DGGDFMAELE ELCGDGDAPM  1020
PTIL
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00501DAPTransfer from AT5G09410Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1084610.0AK108461.1 Oryza sativa Japonica Group cDNA clone:002-143-D08, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015647012.10.0PREDICTED: calmodulin-binding transcription activator 1 isoform X1
TrEMBLA0A0D3GTQ80.0A0A0D3GTQ8_9ORYZ; Uncharacterized protein
STRINGORGLA07G0175700.10.0(Oryza glaberrima)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G09410.30.0ethylene induced calmodulin binding protein